PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 183aa    MW: 19938.5 Da    PI: 10.3674
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25430genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.37.5e-341067259
              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
              +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp vv++tYeg+H+h+
  EMT25430 10 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCVVKKRVERSFQDPAVVITTYEGKHTHP 67
              8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.6E-33269IPR003657WRKY domain
SuperFamilySSF1182909.02E-30369IPR003657WRKY domain
PROSITE profilePS5081132.214469IPR003657WRKY domain
SMARTSM007745.7E-39968IPR003657WRKY domain
PfamPF031062.6E-261067IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTTQKC VVKKRVERSF QDPAVVITTY  60
EGKHTHPIPS ALRGSTHLLA AQAAHLHHQH HGHLARPRAP RAPHGMTPPM IGAGAGHQAS  120
TQGLPGSISS VASATASSPP SLQMQHFMAP DFGLLQDMLP SFIHGAGGNN NNNQPSSPYG  180
KLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-302701078Probable WRKY transcription factor 4
1wj2_A9e-302701078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3580521e-127AK358052.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1067K13.
GenBankAK3668371e-127AK366837.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569516.19e-70PREDICTED: probable WRKY transcription factor 71
SwissprotQ93WV47e-49WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLM8BKB61e-135M8BKB6_AEGTA; Uncharacterized protein
STRINGBRADI2G45900.13e-69(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-48WRKY DNA-binding protein 71